0
    0
    Your Cart
    Your cart is emptyReturn to Shop
      Calculate Shipping
      Apply Coupon
      Available Coupons
      cmoudy01 Get 10% off
      crypto Get 10% off
      lindsey01 Get 10% off
      neffy01 Get 10% off
      psf10 Get 10% off
      Unavailable Coupons
      #3024 Get $10.00 off $10 off when you spend a $100
      #3282 Get $10.00 off
        Products you might like

        peptidebasics.net

        VIP PEPTIDE 5MG

        Original price was: $61.25.Current price is: $45.94.

        Vasoactive intestinal peptide (VIP) is a 28-amino acid peptide with diverse physiological roles, particularly in the nervous and immune systems. Research focuses on its immunomodulatory effects, its role in gastrointestinal and respiratory functions, and its potential in treating conditions like pulmonary hypertension and inflammatory disorders.

        6 in stock

        Category:

        VIP Peptide 5mg – Vasoactive Intestinal Peptide (≥99% Purity) Research Chemical

        28-amino acid neuropeptide | CAS 40077-57-4 | For in vitro & laboratory research only

        What is VIP (Vasoactive Intestinal Peptide)?

        Vasoactive Intestinal Peptide (VIP) is a 28-amino acid neuropeptide that acts as a neurotransmitter and hormone. First isolated in 1970, VIP is widely distributed in the central and peripheral nervous systems and plays key roles in vasodilation, smooth muscle relaxation, immune modulation, and gastrointestinal function.

        Researchers use synthetic VIP peptide to study VPAC1/VPAC2 receptor signaling, cAMP pathways, neuroprotection, pulmonary hypertension models, and inflammatory bowel disease models.

        Key Research Applications & Benefits of VIP Peptide 10mg

        • Potent vasodilator – increases blood flow in preclinical models
        • Immunomodulatory effects – inhibits pro-inflammatory cytokines
        • Regulates gastrointestinal motility and secretion
        • Potential neuroprotective properties in neuroscience research
        • Studied in pulmonary hypertension and erectile dysfunction models

        Product Specifications – VIP Peptide 10mg

        Attribute Details
        CAS Number 40077-57-4
        Purity ≥99% (HPLC verified)
        Molecular Formula C147H238N44O42S
        Molecular Weight 3326.8 Da
        Sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
        Appearance White lyophilized powder
        Quantity 5mg per vial
        Storage Store at -20°C (long-term), 4°C (short-term)
        Solubility Soluble in water and sterile saline

        Scientific References & Research

        VIP acts primarily through VPAC1 and VPAC2 G-protein-coupled receptors, increasing intracellular cAMP. Key studies:

        • Said SI, Mutt V. Polypeptide with broad biological activity: isolation from small intestine. Science. 1970.
        • Delgado M, Ganea D. Vasoactive intestinal peptide: a neuropeptide with pleiotropic immune functions. Amino Acids. 2013.

         

        © 2025 Peptide Basics. All rights reserved. | For research purposes only.

         

        Weight .1 lbs